PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.09G001300.1.p
Common NameGLYMA_09G001300, LOC100792626
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 685aa    MW: 78230 Da    PI: 8.0621
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.09G001300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1773.8e-2428113289
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                          +Y++YAk+vGFs  +++s++s+ +g++++++f C+++g++ + +k   k +r r++ +t+Cka+++vk++ +g+w ++++ ++HnH+ 
  Glyma.09G001300.1.p  28 YYQTYAKSVGFSAIIKASRRSRISGNFIDAKFACTRYGTPPNPQKP--KPKRARTSPKTDCKASMHVKRTPHGTWIISSFIKHHNHQT 113
                          9*****************************************9999..99999*********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2228113IPR004330FAR1 DNA binding domain
PfamPF105514.4E-28190283IPR018289MULE transposase domain
PROSITE profilePS509669.186471507IPR007527Zinc finger, SWIM-type
PfamPF044340.0014479503IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MEPEPEPKLE PEPEPGPEFS SKEEAFSYYQ TYAKSVGFSA IIKASRRSRI SGNFIDAKFA  60
CTRYGTPPNP QKPKPKRART SPKTDCKASM HVKRTPHGTW IISSFIKHHN HQTNSNNNAS  120
PSRKPKIKKT LHHLVFAEGD LQFLLDTFMS MQNENPNFFY AVDFNEEQRL RTVFWVDAKA  180
RLDYRHFSDV VLLDTMHVKN ECKLPFVPFV GVNHHFQVFL LGLAFVSDES ESTFSWLMRS  240
WLRAMGGCAP KVMLTDCDEA LKKAVAEVAP ESWHCFCLWH VLSKVPEKLG RVMQRHGGEF  300
LTRFNECVLR SRTKEQFEKR WGKMVGKFEL GDESWLWDIY EDRERWVPAF MKGRVLAGLS  360
TVQRSEAMNC LFDKYVQRKT TLKEFVEQYR VVLQDKCEEE AKADFVTLHR QPALKSPSPY  420
GKQMVELYTN EVFKKFQSEV LGAVACHPRK EREDGPTKVF RVQDFEDNED FVVTWNESTL  480
EVLCACYLFE FNGFLCRHVM IVLQISAVHS IPPRYILKRW TKDAKSRQTA GDLSMSDAVV  540
SDSRAKRYNN LCQQAFQLGD VGSLSQESYI AAINALEAAL RKCKSLNDSI HSVKEPNLPC  600
SGSQEGILIS NSVGHSNKRD STLGKRKVCP EPETVAIGVN SNWQQVENSN TQAAGLDCSY  660
ESQQSIQEMG QLNSSSEPGW LFFF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.623570.0somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586733.10.0PREDICTED: protein FAR-RED ELONGATED HYPOCOTYL 3-like isoform X1
TrEMBLK7LB160.0K7LB16_SOYBN; Uncharacterized protein
STRINGGLYMA09G00346.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein